PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA65G00028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 851aa    MW: 96432.2 Da    PI: 6.6119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA65G00028genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.3e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
       AA65G00028  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding34.45.1e-1160103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k+l++  W+tIa  +g  Rt+ qc +r+ k+l
       AA65G00028  60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.3E-131070No hitNo description
CDDcd001671.50E-111053No hitNo description
SuperFamilySSF466898.27E-2133109IPR009057Homeodomain-like
CDDcd116596.66E-3055106No hitNo description
Gene3DG3DSA:1.10.10.605.7E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.67558107IPR017930Myb domain
SMARTSM007172.3E-1258105IPR001005SANT/Myb domain
PfamPF118316.5E-56407656IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLLPTQ WRTIAPIVGR TPSQCLERYE KLLDAACTKD ENYEAADDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDGRHR KRKRKGIDYN AEIPFEKRAP AGFYDTANED RPADQIKFPT  240
TIEELEGKRR ADVEAHLRKQ DIARNKIAQR QDAPAAILQA NKLNDPEAVR KRSKLMLPPP  300
QISDHELEEI AKMGYASDLL AENEELTEGS AATRALLANY SQTPRQGMTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRDSQT PLLGGDNPEL HPSDFSGVTP RKKEIQTPNP LLTPSMTPGG  420
AGLTPRIGLT PSRDGSSFAM TPKGTPYRDE LHINEDMDIQ ESAKLERQRR EEARRSLISG  480
LTGLPQPKNE YQIVAQPPPD ESEEPEEKIE EDMSDRLARE RAEEEARHQA LLRKRSKVLQ  540
RDLPRPPAAS LDLIRNSLLS ADGDKSSFVP PTPIEVADEM VRKELLQLLE HDNAKYPLDE  600
KTEKKKGAKN RASSSVSQVP AIEDFEENEL KEAAKMIEEE GQLLRVAMGH ENESLDDFVE  660
AHVTCVNDLM YFPTRNAYGL SSVAGNAEKV AALQVEMEHV RKKIEEDEKK AEHMKTKYKT  720
YTKGHERRAE TLWSQIESTL KQIDIGGTEV ECFKALKRQE EMAASFRKRN LEQEVVKQKE  780
TERKLQARYG NLLSVLEKAE ELMIGFRAQA LKQEDAELRN GEESQKLKEA KVASGEEETT  840
GKLDVAMEAS A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDGRHRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0930570.0AY093057.1 Arabidopsis thaliana putative Myb DNA-binding protein (At1g09770) mRNA, complete cds.
GenBankAY5195530.0AY519553.1 Arabidopsis thaliana MYB transcription factor (At1g09770) mRNA, complete cds.
GenBankBT0088010.0BT008801.1 Arabidopsis thaliana At1g09770 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172448.10.0cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A087HMC30.0A0A087HMC3_ARAAL; Uncharacterized protein
STRINGAT1G09770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5